missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kv11.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Kv11.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18382945 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18382945 25 μg 25µL
18351477 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18382945 Supplier Novus Biologicals Supplier No. NBP31787525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Kv11.2 Polyclonal antibody specifically detects Kv11.2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Kv11.2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias eag related protein 2, eag-related gene member 2, Eag-related protein 2, erg2, ERG-2, ether-a-go-go related gene potassium channel 2, Ether-a-go-go-related gene potassium channel 2, Ether-a-go-go-related protein 2, hERG-2, HERG2, Kv11.2, potassium voltage-gated channel subfamily H member 6, potassium voltage-gated channel, subfamily H (eag-related), member 6, Voltage-gated potassium channel subunit Kv11.2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 81033
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.