missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv11.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10366-25UL
This item is not returnable.
View return policy
Description
Kv11.1 Polyclonal specifically detects Kv11.1 in Human samples. It is validated for Western Blot.
Specifications
| Kv11.1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Eag homolog, Eag-related protein 1, ERG, erg1, ERG-1, Ether-a-go-go-related gene potassium channel 1, ether-a-go-go-related potassium channel protein, Ether-a-go-go-related protein 1, H-ERG, HERG1, HERGhERG-1, Kv11.1, LQT2, potassium voltage-gated channel subfamily H member 2, potassium voltage-gated channel, subfamily H (eag-related), member 2, SQT1, Voltage-gated potassium channel subunit Kv11.1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human Kv11.1 (NP_742054). Peptide sequence SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG | |
| 25 μg | |
| Neuroscience, Neurotransmission, Potassium Channels | |
| 3757 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction