Kv10.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17509-25UL

Product Code. 18325625

Description

Kv10.2 Polyclonal antibody specifically detects Kv10.2 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: Kv10.2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: hEAG2, potassium channel HEAG2, potassium voltage-gated channel, subfamily H (eag-related), member 5, voltage-gated potassium channel subunit Kv10.2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
• Quantity: 25 μg
• Research Discipline: Apoptosis, Cancer, DNA Double Strand Break Repair, Protein Phosphatase, Signal Transduction, Tumor Suppressors
• Gene ID (Entrez): 27133
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified