Kv1.3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48533

Product Code. 18611959

Description

Kv1.3 Polyclonal antibody specifically detects Kv1.3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Kv1.3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: HGK5, HLK3KV1.3, HPCN3PCN3, HUKIII, Kv1.3, MK3, potassium channel 3, potassium voltage-gated channel subfamily A member 3, potassium voltage-gated channel, shaker-related subfamily, member 3, type n potassium channel, Voltage-gated K(+) channel HuKIII, voltage-gated potassium channel protein Kv1.3, Voltage-gated potassium channel subunit Kv1.3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIK
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 3738
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified