missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kv1.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Kv1.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18354134 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18354134 25 μg 25µL
18314166 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18354134 Supplier Novus Biologicals Supplier No. NBP31029425UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Kv1.2 Polyclonal specifically detects Kv1.2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Kv1.2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 3.6.1.27, EC 6.1.1, HBK5, HK4, HUKIV, Kv1.2, MGC50217, MK2, NGK1, potassium channel, potassium voltage-gated channel subfamily A member 2, potassium voltage-gated channel, shaker-related subfamily, member 2, RBK2, Voltage-gated K(+) channel HuKIV, Voltage-gated potassium channel HBK5, voltage-gated potassium channel protein Kv1.2, Voltage-gated potassium channel subunit Kv1.2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human Kv1.2 (NP_001191198.1). Peptide sequence VATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLA
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Neuroscience, Neurotransmission, Potassium Channels
Primary or Secondary Primary
Gene ID (Entrez) 3737
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.