missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Kv1.2 Polyclonal specifically detects Kv1.2 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Kv1.2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 3.6.1.27, EC 6.1.1, HBK5, HK4, HUKIV, Kv1.2, MGC50217, MK2, NGK1, potassium channel, potassium voltage-gated channel subfamily A member 2, potassium voltage-gated channel, shaker-related subfamily, member 2, RBK2, Voltage-gated K(+) channel HuKIV, Voltage-gated potassium channel HBK5, voltage-gated potassium channel protein Kv1.2, Voltage-gated potassium channel subunit Kv1.2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human Kv1.2 (NP_004965.1). Peptide sequence AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?