KV1.1 (KCNA1) Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Brand:  Invitrogen PA577577

Product Code. 15924085

Description

Product is shipped at room temperature as a lyophilized powder and should be stored at -20C upon receipt. Reconstitute using 50 uL deionized water.

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments, and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif. The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia.

Specifications

• Antigen: KV1.1 (KCNA1)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: KCNA1
• Gene Alias: Kcna1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16485, 24520, 3736
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot
• Concentration: 0.75 mg/mL
• Formulation: PBS with 1% BSA and 0.05% sodium azide; pH 7.4
• Gene Accession No.: P10499, P16388, Q09470
• Gene Symbols: KCNA1
• Immunogen: GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv 1.1
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG