missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ku80/XRCC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £435.00
Specifications
| Antigen | Ku80/XRCC5 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18438071
|
Novus Biologicals
NBP1-87829 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18478261
|
Novus Biologicals
NBP1-87829-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ku80/XRCC5 Polyclonal antibody specifically detects Ku80/XRCC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Ku80/XRCC5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 7520 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title