missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KRTAP8-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | KRTAP8-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KRTAP8-1 Polyclonal specifically detects KRTAP8-1 in Human samples. It is validated for Western Blot.Specifications
| KRTAP8-1 | |
| Polyclonal | |
| Rabbit | |
| NP_787053 | |
| 337879 | |
| Synthetic peptide directed towards the middle region of human KRTAP8-1. Peptide sequence LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| keratin associated protein 8-1, keratin-associated protein 8-1 | |
| KRTAP8-1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title