missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KRT85 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-59670
This item is not returnable.
View return policy
Description
KRT85 Polyclonal specifically detects KRT85 in Human samples. It is validated for Western Blot.
Specifications
| KRT85 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KRT85 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT85. 507 amino acids: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT. Peptide sequence: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT | |
| Affinity purified | |
| RUO | |
| 3891 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Keratin 85 | |
| Rabbit | |
| 55 kDa | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Sheep | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction