KRT33A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18300856	Novus Biologicals NBP3-09573-100UL	100 μg

Description

KRT33A Polyclonal specifically detects KRT33A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KRT33A
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: KRTHA3A
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT33A. Peptide sequence NQVLNETRSQYEALVETNRREVEQWFATQTEELNKQVVSSSEQLQSYQAE
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 3883
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.