missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KRR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00
Specifications
| Antigen | KRR1 |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500-1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KRR1 Polyclonal specifically detects KRR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| KRR1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11103 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500-1:5000 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| HIV-1 Rev binding protein 2, HIV-1 Rev-binding protein 2, HRB2, KRR1 small subunit processome component homolog, KRR1, small subunit (SSU) processome component, homolog (yeast), Rev interacting protein, Rev-interacting protein 1, Rip-1 | |
| KRR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title