missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KMT3B/NSD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | KMT3B/NSD1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18219461
|
Novus Biologicals
NBP2-56325 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635687
|
Novus Biologicals
NBP2-56325-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KMT3B/NSD1 Polyclonal specifically detects KMT3B/NSD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| KMT3B/NSD1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, Cellular Markers, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64324 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSEC | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Androgen receptor coactivator 267 kDa protein, Androgen receptor-associated protein of 267 kDa, ARA267STO, DKFZp666C163, EC 2.1.1.43, FLJ10684, FLJ22263, FLJ44628, H3 lysine-36 and H4 lysine-20 specific, KMT3BSotos syndrome, Lysine N-methyltransferase 3B, NR-binding SET domain-containing protein, nuclear receptor binding SET domain protein 1 | |
| NSD1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title