missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KMT2D Monoclonal antibody specifically detects KMT2D in Human samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | KMT2D |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 2E1 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003473 |
| Gene Alias | AAD10, ALRALL1-related protein, CAGL114, EC 2.1.1.43, histone-lysine N-methyltransferase MLL2, KMT2D, Lysine N-methyltransferase 2B, MLL4, myeloid/lymphoid or mixed-lineage leukemia 2, Myeloid/lymphoid or mixed-lineage leukemia protein 2, TNRC21, trinucleotide repeat containing 21 |
| Host Species | Mouse |
| Immunogen | MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?