missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18327868

KMT2B Antibody (4C10), Novus Biologicals™

Product Code. 18327868 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327868 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327868 Supplier Novus Biologicals Supplier No. H00009757M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

KMT2B Monoclonal antibody specifically detects KMT2B in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen KMT2B
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4C10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055542
Gene Alias EC 2.1.1.43, histone-lysine N-methyltransferase MLL4, HRX2, KIAA0304WW domain-binding protein 7, Lysine N-methyltransferase 2D, mixed lineage leukemia gene homolog 2, MLL2, myeloid/lymphoid or mixed-lineage leukemia 4, Myeloid/lymphoid or mixed-lineage leukemia protein 4, Trithorax homolog 2, trithorax homologue 2, TRX2, WBP7, WBP-7, WW domain binding protein 7
Host Species Mouse
Immunogen MLL4 (NP_055542, 813 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 9757
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.