missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | KLHL8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHL8 Polyclonal specifically detects KLHL8 in Human samples. It is validated for Western Blot.Specifications
| KLHL8 | |
| Polyclonal | |
| Rabbit | |
| NP_065854 | |
| 57563 | |
| Synthetic peptide directed towards the middle region of human KLHL8. Peptide sequence TVEAFDPVLNRWELVGSVSHCRAGAGVAVCSCLTSQIRDVGHGSNNVVDC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| kelch-like 8 (Drosophila), kelch-like protein 8, KIAA1378FLJ46304 | |
| KLHL8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title