missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KLHL7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHL7 Polyclonal specifically detects KLHL7 in Human samples. It is validated for Western Blot.Specifications
| KLHL7 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| kelch (Drosophila)-like 6, kelch/BTB, kelch-like 6, kelch-like 7 (Drosophila), kelch-like protein 7, KLHL6, RP42, SBBI26 | |
| KLHL7 | |
| IgG | |
| 62 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IXQ5-2 | |
| 55975 | |
| Synthetic peptides corresponding to KLHL7(kelch-like 7 (Drosophila)) The peptide sequence was selected from the middle region of KLHL7. Peptide sequence AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title