missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL31 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70594
This item is not returnable.
View return policy
Description
KLHL31 Polyclonal specifically detects KLHL31 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| KLHL31 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KLHL31 | |
| Synthetic peptides corresponding to KLHL31(kelch-like 31 (Drosophila)) The peptide sequence was selected from the C terminal of KLHL31. Peptide sequence TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP. | |
| Affinity purified | |
| RUO | |
| 401265 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| bA345L23.2, BKLHD6, BTB and kelch domain-containing protein 6, KBTBD1, kelch repeat and BTB (POZ) domain containing 1, kelch repeat and BTB domain-containing protein 1, kelch-like 31 (Drosophila), kelch-like protein 31, kelch-like protein KLHL, KLHL | |
| Rabbit | |
| 70 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction