missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KLHL22 Polyclonal antibody specifically detects KLHL22 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | KLHL22 |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | FLJ14360, KELCHL, kelch-like 22 (Drosophila), kelch-like protein 22 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYDPATNSWAYVAPLKREVYAHAG |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?