missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KLHL13 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHL13 Polyclonal specifically detects KLHL13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| KLHL13 | |
| Polyclonal | |
| Rabbit | |
| NP_277030 | |
| 90293 | |
| Synthetic peptide directed towards the N terminal of human KLHL13. Peptide sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| BTB and kelch domain containing 2, BTB and kelch domain-containing protein 2, kelch-like 13 (Drosophila), kelch-like protein 13, KIAA1309, MGC74791 | |
| KLHL13 | |
| IgG | |
| 74 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title