missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHDC8B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | KLHDC8B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHDC8B Polyclonal specifically detects KLHDC8B in Human samples. It is validated for Western Blot.Specifications
| KLHDC8B | |
| Polyclonal | |
| Rabbit | |
| FLJ11302, FP17659, kelch domain containing 8B | |
| KLHDC8B | |
| IgG | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 200942 | |
| Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the middle region of KLHDC8B. Peptide sequence AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title