missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHDC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KLHDC5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHDC5 Polyclonal specifically detects KLHDC5 in Human samples. It is validated for Western Blot.Specifications
| KLHDC5 | |
| Polyclonal | |
| Rabbit | |
| NP_065833 | |
| 57542 | |
| Synthetic peptide directed towards the N terminal of human KLHDC5. Peptide sequence LQEACLRFMVVHFHEVLCKPQFHLLGSPPQAPGDVSLKQRLREARMTGTP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Ctb9, kelch domain containing 5, kelch domain-containing protein 5, KIAA1340, MGC131714 | |
| KLHDC5 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title