missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KLHDC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHDC1 Polyclonal specifically detects KLHDC1 in Human samples. It is validated for Western Blot.Specifications
| KLHDC1 | |
| Polyclonal | |
| Rabbit | |
| Q8N7A1 | |
| 122773 | |
| Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| kelch domain containing 1, kelch domain-containing protein 1, MGC126644, MGC126646, MST025 | |
| KLHDC1 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title