missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18399787

KLF9 Antibody (1H5), Novus Biologicals™

Product Code. 18399787 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18399787 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18399787 Fournisseur Novus Biologicals Code fournisseur H00000687M01

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse Monoclonal Antibody

KLF9 Monoclonal antibody specifically detects KLF9 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Spécification

Antigen KLF9
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1H5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001197
Gene Alias basic transcription element binding protein 1, Basic transcription element-binding protein 1, BTEB1GC-box-binding protein 1, BTEBBTE-binding protein 1, Krueppel-like factor 9, Kruppel-like factor 9, Transcription factor BTEB1
Host Species Mouse
Immunogen KLF9 (NP_001197, 25 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 687
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.