missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLF6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £461.00
Specifications
| Antigen | KLF6 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18074614
|
Novus Biologicals
NBP2-57355 |
100 μL |
£461.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685677
|
Novus Biologicals
NBP2-57355-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KLF6 Polyclonal specifically detects KLF6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KLF6 | |
| Polyclonal | |
| Rabbit | |
| Prostate Cancer | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1316 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BCD1Zf9, B-cell-derived protein 1, COPEBCBA1, core promoter element binding protein, Core promoter element-binding protein, CPBPZF9, DKFZp686N0199, EC 2.1.1.43, EC 6.1.1.15, GBF, GC-rich binding factor, GC-rich sites-binding factor GBF, Krueppel-like factor 6, Kruppel-like factor 6, Kruppel-like zinc finger protein Zf9, PAC1, Proto-oncogene BCD1, protooncogene B-cell derived 1, ST12, suppression of tumorigenicity 12 (prostate), Suppressor of tumorigenicity 12 protein, Transcription factor Zf9 | |
| KLF6 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title