KLF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-57746

Codice prodotto. 18206492

Descrizione

KLF3 Polyclonal specifically detects KLF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifica

• Antigen: KLF3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KLF3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDL
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 51274
• Target Species: Human
• Isotype: IgG

For Research Use Only