missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | KLF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLF3 Polyclonal specifically detects KLF3 in Rat samples. It is validated for Western Blot.Specifications
| KLF3 | |
| Polyclonal | |
| Rabbit | |
| NP_001099212 | |
| 51274 | |
| Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2 | |
| KLF3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title