missing translation for 'onlineSavingsMsg'
Learn More

KLF2 Antibody (1D12), Novus Biologicals™

Product Code. 18390869 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18390869 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18390869 Supplier Novus Biologicals Supplier No. H00010365M09

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

KLF2 Monoclonal antibody specifically detects KLF2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen KLF2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1D12
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057354
Gene Alias Krueppel-like factor 2, Kruppel-like factor 2 (lung), Kruppel-like factor LKLF, LKLFLung krueppel-like factor, lung Kruppel-like zinc finger transcription factor
Host Species Mouse
Immunogen KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10365
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.