KLF12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18256252	Novus Biologicals NBP2-56075	100 μL
18617926	Novus Biologicals NBP2-56075-25ul	25 μL

Description

KLF12 Polyclonal specifically detects KLF12 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: KLF12
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA replication Transcription Translation and Splicing
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 11278
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: AP-2rep, AP-2rep transcription factor, AP2REPAP-2 repressor, HSPC122, KLF12 zinc finger transcriptional repressor, Krueppel-like factor 12, Kruppel-like factor 12, Transcriptional repressor AP-2rep
• Gene Symbols: KLF12
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only