missing translation for 'onlineSavingsMsg'
Learn More

KLF1 Antibody (5G12), Novus Biologicals™

Product Code. 18356738 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18356738 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Produktkod. 18356738 Leverantör Novus Biologicals Leverantörsnummer H00010661M04

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Mouse Monoclonal Antibody

KLF1 Monoclonal antibody specifically detects KLF1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen KLF1
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 5G12
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006554
Gene Alias EKLFerythroid-specific transcription factor EKLF, Erythroid krueppel-like transcription factor, erythroid Kruppel-like factor, HBFQTL6, INLU, Krueppel-like factor 1, Kruppel-like factor 1 (erythroid), monoclonal A3D8
Host Species Mouse
Immunogen KLF1 (NP_006554, 183 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10661
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG3 κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.