missing translation for 'onlineSavingsMsg'
Learn More

KLF1 Antibody (5D7), Novus Biologicals™

Product Code. 18387258 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387258 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387258 Supplier Novus Biologicals Supplier No. H00010661M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

KLF1 Monoclonal antibody specifically detects KLF1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen KLF1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 5D7
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006554
Gene Alias EKLFerythroid-specific transcription factor EKLF, Erythroid krueppel-like transcription factor, erythroid Kruppel-like factor, HBFQTL6, INLU, Krueppel-like factor 1, Kruppel-like factor 1 (erythroid), monoclonal A3D8
Host Species Mouse
Immunogen KLF1 (NP_006554, 183 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10661
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.