Novus Biologicals KLF1 Antibody (4E10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00010661-M02

Product Code. 18310689

Description

KLF1 Monoclonal antibody specifically detects KLF1 in Human, Mouse samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: KLF1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: EKLFerythroid-specific transcription factor EKLF, Erythroid krueppel-like transcription factor, erythroid Kruppel-like factor, HBFQTL6, INLU, Krueppel-like factor 1, Kruppel-like factor 1 (erythroid), monoclonal A3D8
• Immunogen: KLF1 (NP_006554, 183 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
• Quantity: 0.1 mg
• Research Discipline: Cancer
• Gene ID (Entrez): 10661
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG3 κ

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 4E10
• Dilution: Western Blot 1:500, ELISA, Sandwich ELISA
• Gene Accession No.: NP_006554
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified