missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIR5.1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | KIR5.1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KIR5.1 Polyclonal specifically detects KIR5.1 in Rat samples. It is validated for Western Blot.Specifications
| KIR5.1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| BIR9, Inward rectifier K(+) channel Kir5.1, inward rectifier K+ channel KIR5.1, inward rectifier potassium channel 16, KIR5.1, MGC33717, Potassium channel, inwardly rectifying subfamily J member 16, potassium inwardly-rectifying channel, subfamily J, member 16 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Rat KIR5.1 (NP_445766). Peptide sequence VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 3773 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title