missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIR3DL2/CD158k Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | KIR3DL2/CD158k |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KIR3DL2/CD158k Polyclonal specifically detects KIR3DL2/CD158k in Human samples. It is validated for Western Blot.Specifications
| KIR3DL2/CD158k | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| killer cell immunoglobulin-like receptor 3DL2, CD158K, killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2, NKAT4, NKAT-4, NKAT4B, p140 | |
| The immunogen for Anti-KIR3DL2/CD158k antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2 (NP_006728.2). Peptide sequence IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 3812 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title