KIR2DS4/CD158i Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09976-100UL

Product Code. 18359966

Description

KIR2DS4/CD158i Polyclonal specifically detects KIR2DS4/CD158i in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KIR2DS4/CD158i
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CD158 antigen-like family member I, CD158I, CD158i antigen, cl-39, killer cell immunoglobulin-like receptor 2DS4, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail4,nkat8, killer inhibitory receptor 4-1-2, KIR antigen 2DS4, KKA3KIR1D, MGC120019, MGC125315, MGC125317, MHC class I NK cell receptor, natural killer cell inhibitory receptor, Natural killer-associated transcript 8, NKAT-8, NKAT8KIR412, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17
• Immunogen: The immunogen for Anti-KIR2DS4/CD158i antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 (NP_036446.3). Peptide sequence RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3809
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.