missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KIR2DS4/CD158i Rabbit anti-Human, Polyclonal, Novus Biologicals™

KIR2DS4/CD158i Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18359966 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359966 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359966 Supplier Novus Biologicals Supplier No. NBP309976100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

KIR2DS4/CD158i Polyclonal specifically detects KIR2DS4/CD158i in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen KIR2DS4/CD158i
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias CD158 antigen-like family member I, CD158I, CD158i antigen, cl-39, killer cell immunoglobulin-like receptor 2DS4, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail4,nkat8, killer inhibitory receptor 4-1-2, KIR antigen 2DS4, KKA3KIR1D, MGC120019, MGC125315, MGC125317, MHC class I NK cell receptor, natural killer cell inhibitory receptor, Natural killer-associated transcript 8, NKAT-8, NKAT8KIR412, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17
Host Species Rabbit
Immunogen The immunogen for Anti-KIR2DS4/CD158i antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 (NP_036446.3). Peptide sequence RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3809
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.