missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18416679

KIR2DL5/CD158f Antibody, Novus Biologicals™

Product Code. 18416679 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18416679 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18416679 Supplier Novus Biologicals Supplier No. H00057292D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

KIR2DL5/CD158f Polyclonal antibody specifically detects KIR2DL5/CD158f in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen KIR2DL5/CD158f
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. AAI60063.1
Gene Alias CD158F, CD158F1, killer cell immunoglobulin-like receptor 2DL5A, killer cell immunoglobulin-like receptor KIR2DL5A, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A, killer-cell Ig-like receptor, KIR2DL5, KIR2DL5.1, KIR2DL5.3, KIR2DL5B
Host Species Rabbit
Immunogen KIR2DL5A (AAI60063.1, 1 a.a. - 375 a.a.) full-length human protein. MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Purification Method Protein G purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 57292
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.