missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIF25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | KIF25 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
KIF25 Polyclonal specifically detects KIF25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| KIF25 | |
| Polyclonal | |
| Purified | |
| RUO | |
| kinesin family member 25 | |
| KIF25 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| NP_085118 | |
| 3834 | |
| Synthetic peptide directed towards the C terminal of human KIF25. Peptide sequence VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title