KIF22 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17728-100UL

Product Code. 18315535

Description

KIF22 Polyclonal antibody specifically detects KIF22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: KIF22
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Kid, KIDA-328A3.2, kinesin family member 22, kinesin-like 4, Kinesin-like DNA-binding protein, Kinesin-like protein 4, kinesin-like protein KIF22, KNSL4kinesin-like DNA-binding protein pseudogene, OBP, OBP-1, OBP-2, origin of plasmid DNA replication-binding protein, oriP binding protein
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
• Quantity: 100 μg
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 3835
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified