missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIF22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | KIF22 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202752
|
Novus Biologicals
NBP2-57459 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18600999
|
Novus Biologicals
NBP2-57459-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KIF22 Polyclonal specifically detects KIF22 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| KIF22 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3835 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Kid, KIDA-328A3.2, kinesin family member 22, kinesin-like 4, Kinesin-like DNA-binding protein, Kinesin-like protein 4, kinesin-like protein KIF22, KNSL4kinesin-like DNA-binding protein pseudogene, OBP, OBP-1, OBP-2, origin of plasmid DNA replication-binding protein, oriP binding protein | |
| KIF22 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title