missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18385489

KHSRP Antibody (2C7), Novus Biologicals™

Product Code. 18385489 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Quantity:
0.1 mg
Packungsgröße:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18385489 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18385489 Lieferant Novus Biologicals Lieferanten-Nr. H00008570M02

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

KHSRP Monoclonal antibody specifically detects KHSRP in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen KHSRP
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2C7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003676
Gene Alias FBP2far upstream element-binding protein 2, FUBP2p75, FUSE binding protein 2, FUSE-binding protein 2, KH type-splicing regulatory protein, KH-type splicing regulatory protein, KSRPMGC99676
Host Species Mouse
Immunogen KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8570
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.