KHDRBS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18254353	Novus Biologicals NBP2-55220	100 μL

Description

KHDRBS3 Polyclonal specifically detects KHDRBS3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: KHDRBS3
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Etle, etoile, KH domain containing, RNA binding, signal transduction associated 3, SALPRNA-binding protein T-Star, Sam68-like mammalian protein 2, Sam68-like phosphotyrosine protein, Sam68-like phosphotyrosine protein, T-STAR, SLM-2KH domain-containing, RNA-binding, signal transduction-associated protein 3, SLM2TSTAR, T-STAR
• Gene Symbols: KHDRBS3
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10656
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only