missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£368.00
Specifications
| Antigen | KF1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KF1 Polyclonal specifically detects KF1 in Human samples. It is validated for Western Blot.Specifications
| KF1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS buffer, 2% sucrose | |
| 7844 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase RNF103, EC 6.3.2.-, hkf-1, KF-1, KF1ZFP103ZFP-103, MGC102815, ring finger protein 103MGC41857, Zfp-103, Zinc finger protein 103 homolog, zinc finger protein 103 homolog (mouse), zinc finger protein expressed in cerebellum | |
| The immunogen is a synthetic peptide directed towards the middle region of human KF1 (NP_001185880.1). Peptide sequence HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title