missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KDM6A Antibody, Novus Biologicals™

KDM6A Antibody, Novus Biologicals™

Product Code. 18407920 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25ul
Unit Size:
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407920 25ul 25µL
18738313 - -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18407920 Supplier Novus Biologicals Supplier No. NBP18062825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 3 publications

KDM6A Polyclonal specifically detects KDM6A in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen KDM6A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397)., Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias bA386N14.2, bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX)), DKFZp686A03225, EC 1.14.11, EC 1.14.11.-, Histone demethylase UTX, lysine (K)-specific demethylase 6A, MGC141941, ubiquitously transcribed tetratricopeptide repeat protein X-linked, ubiquitously transcribed tetratricopeptide repeat, X chromosome, ubiquitously transcribed TPR protein on the X chromosome, ubiquitously transcribed X chromosome tetratricopeptide repeat protein, ubiquitously-transcribed TPR gene on the X chromosome, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein, UTXlysine-specific demethylase 6A
Gene Symbols KDM6A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7403
Test Specificity Specificity of human KDM6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.