missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KDM2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | KDM2B |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226932
|
Novus Biologicals
NBP3-35627-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232127
|
Novus Biologicals
NBP3-35627-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KDM2B Polyclonal antibody specifically detects KDM2B in Human samples. It is validated for ELISA,Western BlotSpecifications
| KDM2B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| [Histone-H3]-lysine-36 demethylase 1B, CXXC2F-box protein FBL10, CXXC-type zinc finger protein 2, Fbl10, F-box and leucine-rich repeat protein 10JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein, FBXL10, JHDM1BF-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, jumonji C domain-containing histone demethylase 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, lysine (K)-specific demethylase 2B, lysine-specific demethylase 2B, PCCX2EC 1.14.11.27, protein containing CXXC domain 2, Protein JEMMA, Protein-containing CXXC domain 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1).,, Sequence:, SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 84678 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title