KCTD10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80086

Product Code. 18208415

Description

KCTD10 Polyclonal specifically detects KCTD10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCTD10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3, BTB/POZ domain-containing protein KCTD10, FLJ41739, MSTP028, potassium channel tetramerisation domain containing 10, Potassium channel tetramerization domain-containing protein 10, ULR061, ULRO61
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83892
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_114160
• Gene Symbols: KCTD10
• Immunogen: Synthetic peptide directed towards the N terminal of human KCTD10. Peptide sequence MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 92%; Mouse: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only