KCNK7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57882-25ul

Product Code. 18682639

Description

KCNK7 Polyclonal specifically detects KCNK7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: KCNK7
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: K2p7.1, MGC118782, MGC118784, potassium channel subfamily K member 7, potassium channel, subfamily K, member 7, TWIK3, two pore domain K+ channel
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNK7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10089
• Target Species: Human
• Isotype: IgG

For Research Use Only