Novus Biologicals KCNK1 Antibody (4D7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00003775-M01-100ug

Product Code. 18307228

Description

KCNK1 Monoclonal antibody specifically detects KCNK1 in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: KCNK1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: DPK, HOHO1, Inward rectifying potassium channel protein TWIK-1, K2P1, K2p1.1, KCNO1, Potassium channel KCNO1, potassium channel subfamily K member 1, potassium channel, subfamily K, member 1, potassium inwardly-rectifying channel, subfamily K, member 1, TWIK-1, TWIK1HOHO
• Immunogen: KCNK1 (NP_002236.1, 265 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
• Quantity: 100 μg
• Research Discipline: Cancer, Endocrinology, Neuroscience, Signal Transduction
• Gene ID (Entrez): 3775
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ

• Applications: Western Blot, ELISA
• Clone: 4D7
• Dilution: Western Blot, ELISA
• Gene Accession No.: NP_002236.1
• Host Species: Mouse
• Purification Method: Protein A or G purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified