missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18327798

KCNJ15 Antibody (1B2), Novus Biologicals™

Product Code. 18327798 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327798 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327798 Supplier Novus Biologicals Supplier No. H00003772M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

KCNJ15 Monoclonal antibody specifically detects KCNJ15 in Human samples. It is validated for Western Blot, ELISA, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen KCNJ15
Applications Western Blot, ELISA, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 1B2
Conjugate Unconjugated
Dilution Western Blot 1:500RNAi Validation, ELISA, Sandwich ELISA, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002234
Gene Alias inward rectifier K+ channel KIR4.2, inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15, inwardly rectifying subfamily J member 15, KCNJ14, Kir1.3, Kir4.2, MGC13584, potassium inwardly-rectifying channel, subfamily J, member 15
Host Species Mouse
Immunogen KCNJ15 (NP_002234, 290 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3772
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.