missing translation for 'onlineSavingsMsg'
Learn More

KCNH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18301415 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18301415 25 μg 25µL
18336285 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18301415 Supplier Novus Biologicals Supplier No. NBP31710325UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

KCNH1 Polyclonal antibody specifically detects KCNH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen KCNH1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias EAG channel 1, EAG1, EAGeag1, Ether-a-go-go potassium channel 1, ether-a-go-go, Drosophila, homolog of, hEAG1, h-eageag, Kv10.1, MGC142269, potassium channel, voltage-gated, subfamily H, member 1, potassium voltage-gated channel subfamily H member 1, potassium voltage-gated channel, subfamily H (eag-related), member 1, Voltage-gated potassium channel subunit Kv10.1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTD
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 3756
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.