missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18339338

KCNE1 Antibody (5B12), Novus Biologicals™

Product Code. 18339338 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18339338 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18339338 Supplier Novus Biologicals Supplier No. H00003753M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

KCNE1 Monoclonal antibody specifically detects KCNE1 in Human, Rat, Canine, Guinea Pig, Monkey samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen KCNE1
Applications Western Blot, ELISA, Immunocytochemistry, KnockDown
Classification Monoclonal
Clone 5B12
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000210
Gene Alias Delayed rectifier potassium channel subunit IsK, FLJ18426, FLJ38123, IKs producing slow voltage-gated potassium channel subunit beta Mink, ISK, Isk-related subfamily, member 1, JLNS2FLJ94103, LQT2/5, MGC33114, Minimal potassium channel, MinK, potassium voltage-gated channel, Isk-related family, member 1, voltage gated potassiun channel accessory subunit
Host Species Mouse
Immunogen KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 3753
Target Species Human, Rat, Canine, Guinea Pig, Monkey
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.